Protein Info for JDDGAC_07865 in Escherichia coli ECRC98

Name: ureE
Annotation: urease accessory protein UreE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02814: UreE_N
  • amino acids 10 to 61 (52 residues), 51.5 bits, E=5.7e-18
• PF05194: UreE_C
  • amino acids 72 to 154 (83 residues), 104.3 bits, E=3.4e-34

Best Hits

Swiss-Prot: 100% identical to UREE_ECO5E: Urease accessory protein UreE (ureE) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03187, urease accessory protein (inferred from 99% identity to eoh:ECO103_3800)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

• superpathway of allantoin degradation in plants (7/8 steps found)
• urea degradation II (1/1 steps found)

Protein Sequence (154 amino acids)

>JDDGAC_07865 urease accessory protein UreE (Escherichia coli ECRC98)
MLYLTRRVETPAQTTASVTLPVDMRVKSRIKVTLNDGRQAGLLLPRGLLLRDGDILSNEN
GDEFIKVIAADEAVSVVRCADPFMLAKACWHLGNRHVPLQIMPGELRYHHDHVLDDMLRQ
FGLDVDFAHLPFEPEAGAYASKSHAHNHDQEHSH