Protein Info for JDDGAC_07855 in Escherichia coli ECRC98

Name: ureG
Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 8 to 201 (194 residues), 332.3 bits, E=5.4e-104
• PF02492: cobW
  • amino acids 10 to 178 (169 residues), 144.5 bits, E=1.4e-46

Best Hits

Swiss-Prot: 100% identical to UREG_ECO5E: Urease accessory protein UreG (ureG) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03189, urease accessory protein (inferred from 100% identity to eoi:ECO111_1232)

MetaCyc: 66% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• superpathway of allantoin degradation in plants (7/8 steps found)
• urea degradation II (1/1 steps found)

Protein Sequence (205 amino acids)

>JDDGAC_07855 urease accessory protein UreG (Escherichia coli ECRC98)
MNIIKQPLRVGVGGPVGSGKTALLEALCKSMRDTWQLAVVTNDIYTREDQRILTEAGALE
AERIVGVETGGCPHTAIREDASMNLAAVEALSEKFGNLELIFVESGGDNLSATFSPELAD
LTIYVIDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTLRMRGERPWG
FTNLKSGEGLQNIIAFIEEQGMLGK