Protein Info for JDDGAC_07190 in Escherichia coli ECRC98

Name: fhuE
Annotation: ferric-rhodotorulic acid/ferric-coprogen receptor FhuE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF07715: Plug" amino acids 75 to 175 (101 residues), 68.3 bits, see alignment E=8e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 77 to 729 (653 residues), 592.5 bits, see alignment E=6.3e-182 PF00593: TonB_dep_Rec_b-barrel" amino acids 254 to 700 (447 residues), 176.4 bits, see alignment E=1.9e-55

Best Hits

Swiss-Prot: 100% identical to FHUE_ECOLI: FhuE receptor (fhuE) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to eco:b1102)

MetaCyc: 100% identical to ferric coprogen/ferric rhodotorulic acid outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1702

Predicted SEED Role

"Putative OMR family iron-siderophore receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (729 amino acids)

>JDDGAC_07190 ferric-rhodotorulic acid/ferric-coprogen receptor FhuE (Escherichia coli ECRC98)
MLSTQFNRDNQYQAITKPSLLAGCIALALLPSAAFAAPATEETVIVEGSATAPDDGENDY
SVTSTSAGTKMQMTQRDIPQSVTIVSQQRMEDQQLQTLGEVMENTLGISKSQADSDRALY
YSRGFQIDNYMVDGIPTYFESRWNLGDALSDMALFERVEVVRGATGLMTGTGNPSAAINM
VRKHATSREFKGDVSAEYGSWNKERYVADLQSPLTEDGKIRARIVGGYQNNDSWLDRYNS
EKTFFSGIVDADLGDLTTLSAGYEYQRIDVNSPTWGGLPRWNTDGSSNSYDRARSTAPDW
AYNDKEINKVFMTLKQRFADTWQATLNATHSEVEFDSKMMYVDAYVNKADGMLVGPYSNY
GPGFDYVGGTGWNSGKRKVDALDLFADGSYELFGRQHNLMFGGSYSKQNNRYFSSWANIF
PDEIGSFYNFNGNFPQTDWSPQSLAQDDTTHMKSLYAATRVTLADPLHLILGARYTNWRV
DTLTYSMEKNHTTPYAGLVFDINDNWSTYASYTSIFQPQNDRDSSGKYLAPITGNNYELG
LKSDWMNSRLTTTLAIFRIEQDNVAQSTGTPIPGSNGETAYKAVDGTVSKGVEFELNGAI
TDNWQLTFGATRYIAEDNEGNAVNPNLPRTTVKMFTSYRLPVMPELTVGGGVNWQNRVYT
DTVTPYGTFRAEQGSYALVDLFTRYQVTKNFSLQGNVNNLFDKTYDTNVEGSIVYGAPRN
FSITGTYQF