Protein Info for JDDGAC_06325 in Escherichia coli ECRC98

Name: menH
Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 91 to 460 (370 residues), 115.2 bits, see alignment E=4.1e-37 PF08386: Abhydrolase_4" amino acids 386 to 479 (94 residues), 51.9 bits, see alignment E=7.4e-18

Best Hits

Swiss-Prot: 76% identical to YUAR_ECOLI: Putative hydrolase YuaR (yuaR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_1652)

Predicted SEED Role

"Putative protease encoded within prophage CP-933X"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>JDDGAC_06325 alpha/beta hydrolase (Escherichia coli ECRC98)
MRKIITHFKVVLTLLLPVTVSAQQIQWQSCMASQFNHWFGEEKPSPDLLCGYLSVPLKYT
DTGGDASYEKKSQVKLALTKLPAKSKHKGSILIISGGPGLPGINPYINFDWPVTNLRESW
DIIGFDPRGVGQSTPTINCRQSDTETQENITEKQQVLNKINACIHNTGAEVIRHIGSNEA
VYDIDRIRQALGDKQLTAVAYSYGTQIAALYAERFPYNVRSIVLDGVVDIDDLEDNFTWQ
LKQAQSYQETFDRFASWCARTKSCPLSSDRDKAITQFHELLSKLHHKPLLDSKGENISSD
ELISLTTDLLLWRSSWPTLATAIRQFSQGIVSNEIETALSAPIASEESSDASGVILCVDQ
GDEQLTPEERKFRKEALANAFPAINFDNGRSDSPDFCELWPIHSDLNKTRLKNTVLPSGL
LFVAHKYDPTTPWINARKMAEKFSSPLLTINGDGHTLALTGVNLCVDKAVVHHLITPQKI
ENIYCPGNSEAEIQ