Protein Info for JDDGAC_06290 in Escherichia coli ECRC98

Name: ycgJ
Annotation: Uncharacterized protein YcgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05666: Fels1" amino acids 21 to 59 (39 residues), 54.9 bits, see alignment E=2.8e-19 amino acids 69 to 120 (52 residues), 68.2 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 98% identical to YCGJ_ECOLI: Uncharacterized protein YcgJ (ycgJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b1177)

Predicted SEED Role

"orf, hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>JDDGAC_06290 Uncharacterized protein YcgJ (Escherichia coli ECRC98)
MNMMRIFYIGLSGVGMMFSSMASGHDAGGLQSPACGVVCDPYICVNSDGISPELTRKYLS
EKAAENLQSLQGYDPSEFTFANGVFCDVKEKLCRDDRYFGVDGKRSGKINQTTTKMLFMC
RE