Protein Info for JDDGAC_05910 in Escherichia coli ECRC98

Name: kch
Annotation: voltage-gated potassium channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details PF07885: Ion_trans_2" amino acids 149 to 221 (73 residues), 58.5 bits, see alignment E=4.8e-20 PF02254: TrkA_N" amino acids 246 to 365 (120 residues), 71.3 bits, see alignment E=9e-24

Best Hits

Swiss-Prot: 100% identical to KCH_ECOLI: Voltage-gated potassium channel Kch (kch) from Escherichia coli (strain K12)

KEGG orthology group: K10716, voltage-gated potassium channel (inferred from 100% identity to eco:b1250)

MetaCyc: 100% identical to K+ channel Kch (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Potassium channel protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>JDDGAC_05910 voltage-gated potassium channel protein (Escherichia coli ECRC98)
VSHWATFKQTATNLWVTLRHDILALAVFLNGLLIFKTIYGMSVNLLDIFHIKAFSELDLS
LLANAPLFMLGVFLVLNSIGLLFRAKLAWAISIILLLIALIYTLHFYPWLKFSIGFCIFT
LVFLLILRKDFSHSSAAAGTIFAFISFTTLLFYSTYGALYLSEGFNPRIESLMTAFYFSI
ETMSTVGYGDIVPVSESARLFTISVIISGITVFATSMTSIFGPLIRGGFNKLVKGNNHTM
HRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSND
SSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPD
IILSPQLFGSEILARVLNGEEINNDMLVSMLLNSGHGIFSDNDEQETKADSKESAQK