Protein Info for JDDGAC_04790 in Escherichia coli ECRC98

Name: uspE
Annotation: universal stress protein UspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00582: Usp" amino acids 3 to 146 (144 residues), 75.2 bits, see alignment E=4e-25 amino acids 173 to 300 (128 residues), 59 bits, see alignment E=4.1e-20

Best Hits

Swiss-Prot: 100% identical to USPE_ECOLI: Universal stress protein E (uspE) from Escherichia coli (strain K12)

KEGG orthology group: K14055, universal stress protein E (inferred from 100% identity to eco:b1333)

Predicted SEED Role

"Universal stress protein E" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>JDDGAC_04790 universal stress protein UspE (Escherichia coli ECRC98)
MAMYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAM
RQGVISQRTAWIHEQAKYYLNAGVPIEIKVVWHNRPFEAIIQEVISGGHDLVLKMAHQHD
RLEAVIFTPTDWHLLRKCPSPVWMVKDQPWPEGGKALVAVNLASEEPYHNALNEKLVKET
IELAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFGINE
NMTHVEKGLPEEVIPDLAEHLQAGIVVLGTVGRTGISAAFLGNTAEQVIDHLRCDLLVIK
PDQYQTPVELDDEEDD