Protein Info for JDDGAC_04255 in Escherichia coli ECRC98

Name: pdxI
Annotation: pyridoxine 4-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 15 to 284 (270 residues), 166.4 bits, E=3.9e-53

Best Hits

Swiss-Prot: 99% identical to PDXI_ECOLI: Pyridoxine 4-dehydrogenase (pdxI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1406)

MetaCyc: 99% identical to pyridoxal reductase (Escherichia coli K-12 substr. MG1655)
Pyridoxine 4-dehydrogenase. [EC: 1.1.1.65]; RXN0-7143 [EC: 1.1.1.65]

Predicted SEED Role

"Aldo-keto reductase"

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.65

Protein Sequence (286 amino acids)

>JDDGAC_04255 pyridoxine 4-dehydrogenase (Escherichia coli ECRC98)
MSSNTFTLGTKSVNRLGYGAMQLAGPGVFGPPRDRHVAITVLREALALGVNHIDTSDFYG
PHVTNQIIREALYPYSDDLTIVTKIGARRGEDASWLPAFSPAELQKAVHDNLRNLGLDVL
DVVNLRVMMGDGHGPAEGSIEASLTVLAEMQQQGLVKHIGLSNVTPTQVAEARKIAEIVC
VQNEYNIAHRADDAMIEALARDGIAYVPFFPLGGFTPLQSSTLSDVAASLGATPMQVALA
WLLQRSPNILLIPGTSSVAHLRENMAAEKLHLSEKVLSTLDGISRE