Protein Info for JDDGAC_03930 in Escherichia coli ECRC98

Name: yddE
Annotation: PhzF family isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00654: phenazine biosynthesis protein, PhzF family" amino acids 1 to 295 (295 residues), 435.8 bits, see alignment E=4.1e-135 PF02567: PhzC-PhzF" amino acids 8 to 290 (283 residues), 316.9 bits, see alignment E=6.7e-99

Best Hits

Swiss-Prot: 100% identical to YDDE_ECO57: Uncharacterized isomerase YddE (yddE) from Escherichia coli O157:H7

KEGG orthology group: K06998, (no description) (inferred from 100% identity to ecf:ECH74115_2074)

Predicted SEED Role

"Phenazine biosynthesis protein PhzF" in subsystem Phenazine biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>JDDGAC_03930 PhzF family isomerase (Escherichia coli ECRC98)
MKPQVYHVDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFLLHSDDSDVRI
RYFTPTVEVPICGHATVAAHYVRAKVLGLGNCTVWQTSLAGKHRVTIEKHHDGYRISLEQ
GTPGFEPPLEGETRAAIINALHLTEDDILPGLPIQVATTGHSKVMIPLKPEVDIDALSPD
LNALTAISKQIGCNGFFPFQIRPGKNETDGRMFSPAIGIVEDPVTGNANGPMGAWLVHHN
VLPHDGNVLRVKGHQGRALGRDGMIEVTVTIRDNQPEKVTISGAAVILFHAEWAIKL