Protein Info for JDDGAC_03800 in Escherichia coli ECRC98

Name: dosP
Annotation: oxygen-sensing cyclic-di-GMP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00990: GGDEF
  • amino acids 2 to 109 (108 residues), 47.7 bits, E=1.5e-16
• PF00563: EAL
  • amino acids 131 to 365 (235 residues), 240.9 bits, E=1.3e-75

Predicted SEED Role

"Heme-regulated cyclic AMP phosphodiesterase (EC 3.1.4.-)" in subsystem Putative hemin transporter or cAMP signaling in bacteria (EC 3.1.4.-)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ether lipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.-

Use Curated BLAST to search for 3.1.4.-

Protein Sequence (383 amino acids)

>JDDGAC_03800 oxygen-sensing cyclic-di-GMP phosphodiesterase (Escherichia coli ECRC98)
VIDSLGYAWADQALLEVVNRFREKLKPDQYLCRIEGTQFVLVSLENDVSNITQIADELRN
VVSKPIMIDDNPFPLTLSIGISYDVGKNRDYLLSTAHNAMDYIRKNGGNGWQFFSPAMNE
MVKERLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPQHGHVPPSRFIP
LAEEIGEIENIGRWVIAEACRQLAEWRSQNIHIPALSVNLSALHFRSNQLPNQVSDAMQA
WGIDGHQLTVEITESMMMEHDTEIFKRIQILRDMGVGLSVDDFGTGFSGLSRLVSLPVTE
IKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRKIHCRVIQGY
FFSRPLPAEEIPGWMSSVLPLKI