Protein Info for JDDGAC_03710 in Escherichia coli ECRC98

Name: fimC
Annotation: fimbrial chaperone protein FimC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00345: PapD_N" amino acids 33 to 151 (119 residues), 136.3 bits, see alignment E=5.7e-44 PF02753: PapD_C" amino acids 175 to 228 (54 residues), 44.3 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 68% identical to FOCC_ECOLX: Chaperone protein FocC (focC) from Escherichia coli

KEGG orthology group: K07346, fimbrial chaperone protein (inferred from 98% identity to ecc:c1935)

Predicted SEED Role

"chaperone FimC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>JDDGAC_03710 fimbrial chaperone protein FimC (Escherichia coli ECRC98)
MQTTRTPYSISFMATVLLLLLFACHSTVANAAVALGATRVIYPANQKQVLLPVTNNDPAS
VYLIQSWIENAGDQKDTQFVITPPLFSMQGKKENTLRIINATNHQLPGDRESLFWVNVKA
IPAMEKDQKNENTLQLAIISRIKMFYRPTNLAMAPEEAPAMLRFRRSGSNLTLINPTPYF
ITVTNMKAGNSNLPNTMVPPKGEVSVDIPHAATGDISFQTINDYGALTPRIKATMQ