Protein Info for JDDGAC_03695 in Escherichia coli ECRC98

Annotation: Autotransporter domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR01414: outer membrane autotransporter barrel domain" amino acids 6 to 466 (461 residues), 414.9 bits, see alignment E=2.1e-128 PF18883: AC_1" amino acids 9 to 98 (90 residues), 91.1 bits, see alignment E=7.5e-30 PF03212: Pertactin" amino acids 21 to 112 (92 residues), 39.9 bits, see alignment E=5.9e-14 PF03797: Autotransporter" amino acids 185 to 444 (260 residues), 151.2 bits, see alignment E=7e-48

Best Hits

Swiss-Prot: 99% identical to YDEU_ECOLI: Uncharacterized protein YdeU (ydeU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eok:G2583_1874)

Predicted SEED Role

"FIG00637907: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>JDDGAC_03695 Autotransporter domain-containing protein (Escherichia coli ECRC98)
MNSEGGKPGNVLTVNGNYTGNNGLMTFNATLGGDNSPTDKMNVKGDTQGNTRVRVDNIGG
VGAQTVNGIELIEVGGNSAGNFALTTGTVEAGAYVYTLAKGKGNDEKNWYLTSKWDGVTP
ADTPDPINNPPVVDPEGPSVYRPEAGSYISNIAAANSLFSHRLHDRLGEPQYTDSLHSQD
SASSMWMRHVGGHERSSAGDGQLNTQANRYVLQLGGDLAQWSSNAQDRWHLGVMAGYANQ
HSNTQSNRVGYKSDGRISGYSAGLYATWYQNDANKTGAYVDSWALYNWFDNSVSSDNRSA
DDYDSRGVTASVEGGYTFEAGTCSGSEGTLNTWYVQPQAQITWMGVKDSDHARKDGTRIE
TEGDGNVQTRLGVKTYLNSHHQRDDGKQREFQPYIEANWINNSKVYAVKMNGQTVSRDGA
RNLGEVRTGVEAKVNNNLSLWGNVGVQLGDKGYSDTQGMLGVKYSW