Protein Info for JDDGAC_03595 in Escherichia coli ECRC98

Name: marC
Annotation: NAAT family transporter MarC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details PF01914: MarC" amino acids 5 to 217 (213 residues), 220.8 bits, see alignment E=6.6e-70 TIGR00427: membrane protein, MarC family" amino acids 8 to 213 (206 residues), 123.6 bits, see alignment E=4.5e-40

Best Hits

Swiss-Prot: 100% identical to MARC_ECO57: UPF0056 inner membrane protein MarC (marC) from Escherichia coli O157:H7

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 99% identity to eco:b1529)

Predicted SEED Role

"Multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>JDDGAC_03595 NAAT family transporter MarC (Escherichia coli ECRC98)
MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNGAERNRQSLMASVYVFAIMMVAYY
AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIA
FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTNH