Protein Info for JDDGAC_03115 in Escherichia coli ECRC98

Annotation: site-specific integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF12167: Arm-DNA-bind_2" amino acids 4 to 66 (63 residues), 82.8 bits, see alignment E=1.4e-27 PF00589: Phage_integrase" amino acids 201 to 392 (192 residues), 68.1 bits, see alignment E=8.5e-23

Best Hits

Swiss-Prot: 94% identical to INTQ_ECOLI: Putative defective protein IntQ (intQ) from Escherichia coli (strain K12)

KEGG orthology group: K14059, integrase (inferred from 100% identity to eoj:ECO26_2281)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>JDDGAC_03115 site-specific integrase (Escherichia coli ECRC98)
MKYPTGVENHGGKLRIWFVYKGVRVRENLGVPDTAKNRRIAGELRASVCYAIKTGAFDYA
KQFPASHNLEKFGEARQDLTIKELAEKFLALKETEVAKTSLNTYRAVIKNILSIIGEKNL
ASSINKEKLLAVRKELLTGYQIPKSNYIVTQPGRSAVTVNNYMTNLYAVFQFGVDNGYLA
DNPFKGISPLKESRTIPDPLSREEFIRLIDACRNQQAKNLWCVSVYTGIRPGELCALGWE
DIDLKNGTMIIRRNLAKDRFTVPKTQAGTNRVIHLIKPAIDALRSQMALTRLSKEHIIDV
HLREFGRTEKQKCTFVFQPEVSAKVKNYGDHFTVDSIRQMWDAAVKRAGIRHRKSYQSRH
TYACWSLTAGANPAFIANQMGHADAQMVFQVYGKWMSENNNAQVTLLNTQLSEFAPTMPH
NEAMKS