Protein Info for JDDGAC_02000 in Escherichia coli ECRC98

Name: mepH
Annotation: peptidoglycan DD-endopeptidase MepH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00877: NLPC_P60" amino acids 153 to 263 (111 residues), 124.4 bits, see alignment E=9.2e-41

Best Hits

Swiss-Prot: 99% identical to MEPH_ECOLI: Murein DD-endopeptidase MepH (mepH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1655)

MetaCyc: 99% identical to peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase MepH (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]

Predicted SEED Role

"FIG00545237: hypothetical protein"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.13

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>JDDGAC_02000 peptidoglycan DD-endopeptidase MepH (Escherichia coli ECRC98)
VARINRISITLCALLFTTLPLTPMAHASKQARESSATTHITKKADKKKSTATTKKTQKTA
KKAASKSTTKSKTASSVKKSSITASKNAKTRSKHTVNKTASASFTEKCTKRKGYKSHCVK
VKNAASGTLADAHKAKVQKATKVAMNKLMQQIGKPYRWGGSSPRTGFDCSGLVYYAYKDL
VKIRIPRTANEMYHLRDAAPIERSELKNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRT
GQEIQITSLSEDYWQRHYVGARRVMTPKTLR