Protein Info for JDDGAC_01825 in Escherichia coli ECRC98

Name: sufA
Annotation: Fe-S cluster assembly scaffold SufA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR01997: FeS assembly scaffold SufA" amino acids 17 to 122 (106 residues), 170.6 bits, see alignment E=9e-55 PF01521: Fe-S_biosyn" amino acids 18 to 118 (101 residues), 68.9 bits, see alignment E=2.2e-23 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 18 to 121 (104 residues), 110.9 bits, see alignment E=3.4e-36

Best Hits

Swiss-Prot: 99% identical to SUFA_ECOLI: Protein SufA (sufA) from Escherichia coli (strain K12)

KEGG orthology group: K05997, Fe-S cluster assembly protein SufA (inferred from 99% identity to eco:b1684)

MetaCyc: 48% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>JDDGAC_01825 Fe-S cluster assembly scaffold SufA (Escherichia coli ECRC98)
MDMHSGTFNPQDFAWQGLTLTPAAAVHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSV
SEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESF
GV