Protein Info for JDDGAC_01330 in Escherichia coli ECRC98

Name: ydjJ
Annotation: Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF08240: ADH_N" amino acids 26 to 141 (116 residues), 98.9 bits, see alignment E=2.9e-32 PF16912: Glu_dehyd_C" amino acids 166 to 344 (179 residues), 37.4 bits, see alignment E=2.9e-13 PF00107: ADH_zinc_N" amino acids 180 to 305 (126 residues), 98.7 bits, see alignment E=4e-32

Best Hits

Swiss-Prot: 99% identical to YDJJ_ECOLI: Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ (ydjJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1774)

Predicted SEED Role

"Hypothetical zinc-type alcohol dehydrogenase-like protein YdjJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>JDDGAC_01330 Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ (Escherichia coli ECRC98)
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGTLVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGASAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD