Protein Info for JDDGAC_01190 in Escherichia coli ECRC98

Name: yeaW
Annotation: carnitine monooxygenase subunit YeaW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF00355: Rieske" amino acids 46 to 134 (89 residues), 83.3 bits, see alignment E=9.3e-28 PF00848: Ring_hydroxyl_A" amino acids 184 to 371 (188 residues), 80 bits, see alignment E=2.4e-26

Best Hits

Swiss-Prot: 100% identical to CNTA_ECO57: Carnitine monooxygenase oxygenase subunit (yeaW) from Escherichia coli O157:H7

KEGG orthology group: K00517, [EC: 1.14.-.-] (inferred from 100% identity to eco:b1802)

MetaCyc: 100% identical to carnitine monooxygenase subunit YeaW (Escherichia coli K-12 substr. MG1655)
RXN-18258 [EC: 1.14.13.239]; 1.14.13.239 [EC: 1.14.13.239]; 1.14.13.239 [EC: 1.14.13.239]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.- or 1.14.13.239

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>JDDGAC_01190 carnitine monooxygenase subunit YeaW (Escherichia coli ECRC98)
MSNLSPDFVLPENFCANPQEAWTIPARFYTDQNAFEHEKENVFAKSWICVAHSSELANAN
DYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDG
NLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFINMDPNATSVEDQLPGLGAKVLEACP
EVHDLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQY
GFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMTVIYEFPVDSETTLQNYDIY
FTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYRGQGRIMADSSGSGISEHG
IAHFHNLLAQVFKD