Protein Info for JDDGAC_01020 in Escherichia coli ECRC98

Name: yebT
Annotation: lipid-binding membrane homeostasis protein YebT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 877 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF02470: MlaD" amino acids 45 to 137 (93 residues), 68.9 bits, see alignment E=1.9e-23 amino acids 163 to 220 (58 residues), 33.1 bits, see alignment 2.8e-12 amino acids 280 to 353 (74 residues), 39.1 bits, see alignment E=3.7e-14 amino acids 394 to 455 (62 residues), 30.4 bits, see alignment 1.9e-11 amino acids 636 to 724 (89 residues), 47.4 bits, see alignment E=9.4e-17 amino acids 747 to 808 (62 residues), 38.5 bits, see alignment 5.8e-14

Best Hits

Swiss-Prot: 100% identical to YEBT_ECOLI: Intermembrane transport protein YebT (yebT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ebr:ECB_01805)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (877 amino acids)

>JDDGAC_01020 lipid-binding membrane homeostasis protein YebT (Escherichia coli ECRC98)
MSQETPASTTEAQIKNKRRISPFWLLPFIALMIAGWLIWDSYQDRGNTVTIDFMSADGIV
PGRTPVRYQGVEVGTVQDISLSDDLRKIEVKVSIKSDMKDALREETQFWLVTPKASLAGV
SGLDALVGGNYIGMMPGKGKEQDHFVALDTQPKYRLDNGDLMIHLQAPDLGSLNSGSLVY
FRKIPVGKVYDYAINPNKQGVVIDVLIERRFTDLVKKGSRFWNVSGVDANVSISGAKVKL
ESLAALVNGAIAFDSPEESKPAEAEDTFGLYEDLAHSQRGVIIKLELPSGAGLTADSTPL
MYQGLEVGQLTKLDLNPGGKVTGEMTVDPSVVTLLRENTRIELRNPKLSLSDANLSALLT
GKTFELVPGDGEPRKEFVVVPGEKALLHEPDVLTLTLTAPESYGIDAGQPLILHGVQVGQ
VIDRKLTSKGVTFTVAIEPQHRELVKGDSKFVVNSRVDVKVGLDGVEFLGASASEWINGG
IRILPGDKGEMKASYPLYANLEKALENSLSDLPTTTVSLSAETLPDVQAGSVVLYRKFEV
GEVITVRPRANAFDIDLHIKPEYRNLLTNNSVFWAEGGAKVQLNGSGLTVQASPLSRALK
GAISFDNLSGASASQRKGDKRILYASETAARAVGGQITLHAFDAGKLAVGMPIRYLGIDI
GQIQTLDLITARNEVQAKAVLYPEYVQTFARGGTRFSVVTPQISAAGVEHLDTILQPYIN
VEPGRGNPRRDFELQEATITDSRYLDGLSIIVEAPEACSLGIGTPVLFRGLEVGTVTGMT
LGTLSDRVMIAMRISKRYQHLVRNNSVFWLASGYSLDFGLTGGVVKTGTFNQFIRGGIAF
ATPPGTPLAPKAQEGKHFLLQESEPKEWREWGTALPK