Protein Info for JDDGAC_00930 in Escherichia coli ECRC98

Name: yebG
Annotation: DNA damage-inducible protein YebG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07130: YebG
  • amino acids 1 to 74 (74 residues), 116.4 bits, E=2.1e-38

Best Hits

Swiss-Prot: 99% identical to YEBG_ECOLI: Uncharacterized protein YebG (yebG) from Escherichia coli (strain K12)

KEGG orthology group: K09918, hypothetical protein (inferred from 99% identity to eco:b1848)

Predicted SEED Role

"DNA damage-inducible gene in SOS regulon, dependent on cyclic AMP and H-NS"

Protein Sequence (96 amino acids)

>JDDGAC_00930 DNA damage-inducible protein YebG (Escherichia coli ECRC98)
MAVEVKYVVIREGEEKMSFTSKKEADAYDKMLDTADLLDTWLTNSPVQMEDEQREALSLW
LAEQKDVLSTILKTGKLPSPQVVGAESEEEDASRAA