Protein Info for JDDGAC_00810 in Escherichia coli ECRC98

Name: yecE
Annotation: UPF0759 protein YecE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF01904: DUF72" amino acids 21 to 249 (229 residues), 170.6 bits, see alignment E=2.6e-54

Best Hits

Swiss-Prot: 100% identical to YECE_ECO57: UPF0759 protein YecE (yecE) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1868)

Predicted SEED Role

"FIG003003: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>JDDGAC_00810 UPF0759 protein YecE (Escherichia coli ECRC98)
MIYIGLPQWSHPKWVRLGITSLEEYARHFNCVEGNTTLYALPKPEVVLRWREQTTDDFRF
CFKFPATISHQAALRHCDDLVTEFLTRMSPLAPRIGQYWLQLPATFGPRELPALWHFLDS
LPGEFNYGVEVRHPQFFAKGEEEQTLNRGLHQRGVNQVILDSRPVHAARPHSEAIRDAQR
KKPKVPVHAVLTATNPLIRFIGSDDMTQNRELFQVWLQKLAQWHQTTTPYLFLHTPDIAQ
APELVHTLWEDLRKTLPEIGAVPAIPQQSSLF