Protein Info for JDDGAC_00660 in Escherichia coli ECRC98

Name: otsB
Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 12 to 244 (233 residues), 305.7 bits, E=3.3e-95
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 18 to 213 (196 residues), 74.4 bits, E=1.4e-24
• PF02358: Trehalose_PPase
  • amino acids 18 to 231 (214 residues), 193.3 bits, E=3.6e-61

Best Hits

Swiss-Prot: 99% identical to OTSB_ECOLI: Trehalose-6-phosphate phosphatase (otsB) from Escherichia coli (strain K12)

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 99% identity to eco:b1897)

MetaCyc: 99% identical to trehalose-6-phosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Trehalose-phosphatase. [EC: 3.1.3.12]

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Protein Sequence (266 amino acids)

>JDDGAC_00660 trehalose-phosphatase (Escherichia coli ECRC98)
VTEPLTETPELSAKYAWFFDLDGTLAEIKPHPDQVVVPDNILQGLQLLATASDGALALIS
GRSMVELDALAKPYRFPLAGVHGAERRDINGKTHIVHLPDAIARDINVQLHTVIAQYPGA
ELETKGMAFALHYRQAPQHEDALMTLAQRITQIWPQMALQQGKCVVEIKPRGTSKGEAIA
AFMQEAPFIGRTPVFLGDDLTDESGFAVVNRLGGMSVKIGTGATQASWRLAGVPDVWSWL
EMITTALQQKRENNRSDDYESFSRSI