Protein Info for JDDGAC_00300 in Escherichia coli ECRC98

Name: fliF
Annotation: flagellar M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 450 to 468 (19 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 1 to 551 (551 residues), 788.8 bits, see alignment E=1.8e-241 PF01514: YscJ_FliF" amino acids 44 to 218 (175 residues), 231.4 bits, see alignment E=7e-73 PF08345: YscJ_FliF_C" amino acids 250 to 429 (180 residues), 163.4 bits, see alignment E=5e-52

Best Hits

Swiss-Prot: 100% identical to FLIF_ECOLI: Flagellar M-ring protein (fliF) from Escherichia coli (strain K12)

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to ecf:ECH74115_2714)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>JDDGAC_00300 flagellar M-ring protein FliF (Escherichia coli ECRC98)
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSWRDLNDAQLKYASDVEG
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQ
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
LVIRQWINNDHE