Protein Info for IAI46_25210 in Serratia liquefaciens MT49

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 25 to 116 (92 residues), 60.4 bits, see alignment E=1e-20 PF00528: BPD_transp_1" amino acids 44 to 223 (180 residues), 79.7 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_5015)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>IAI46_25210 amino acid ABC transporter permease (Serratia liquefaciens MT49)
MDFSIIYDNLGYLLWGTWPDGPLGGAALTLAISLMAGVASAILGTLLGVALAMSRGVVAG
LLAAVLGFFRAIPVIMLIFWTYFLLPIVFGVDIPEITTVVCALALIASAYLAHAVKAGIA
AIGPGQWQAGLSLGLTRWQTLWLIVLPQALRMMVPSFINQWISLIKDTSLAYIVGVSELT
FLATQVNNRSMVYPMEVFLFIALVYFVFCLALDLLANAINRRYSPQTRAVKRSWRWWRNK
PPLPAS