Protein Info for IAI46_25205 in Serratia liquefaciens MT49

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 85 (68 residues), 62.2 bits, see alignment E=2.8e-21 PF00528: BPD_transp_1" amino acids 38 to 224 (187 residues), 57.7 bits, see alignment E=6.8e-20

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to spe:Spro_0018)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>IAI46_25205 amino acid ABC transporter permease (Serratia liquefaciens MT49)
MNLQQLSDWLLAPQYLSWLWDGFLLTLWLSACASLAATLLGFLLTAMRDSRLRVLRWLAV
GYSSLFRNTPLLVQLFFWYFAAGQILPSAAMQWLNTPHHIGPLEWPSFEFLAGFFGLTLY
STAFIAEEIRSGIRGVASGQKYAANALGLTGWQAMRYVVLPQALKIAMPPLLGQYMNVIK
NSSLTMAIGVAELSYASRQVETETLRTFQAFGVATVLYIAIIALLEGWGMWRQQRKPLGG
H