Protein Info for IAI46_25160 in Serratia liquefaciens MT49

Annotation: F0F1 ATP synthase subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01216: ATP synthase F1, epsilon subunit
  • amino acids 4 to 133 (130 residues), 156.3 bits, E=2e-50
• PF02823: ATP-synt_DE_N
  • amino acids 6 to 84 (79 residues), 108.2 bits, E=1.7e-35
• PF00401: ATP-synt_DE
  • amino acids 89 to 133 (45 residues), 54.3 bits, E=1.2e-18

Best Hits

Swiss-Prot: 99% identical to ATPE_SERP5: ATP synthase epsilon chain (atpC) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 99% identity to spe:Spro_0009)

MetaCyc: 90% identical to ATP synthase F1 complex subunit epsilon (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

• ATP biosynthesis (1/1 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Protein Sequence (139 amino acids)

>IAI46_25160 F0F1 ATP synthase subunit epsilon (Serratia liquefaciens MT49)
MAMTYHLDVVSAEKHMFSGLVQKIQVTGSEGELGIFPGHAPLLTAIKPGMVRIVKQHGEE
EFIYLSGGILEVQPSVVTVLADTAIRGTDLDEARALEAKRKAEEHIRSSHGDVDYAQASA
ELAKAIAKLRVIELTRRAM