Protein Info for IAI46_25085 in Serratia liquefaciens MT49

Annotation: ATPase RavA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 32 to 46 (15 residues), see Phobius details PF20030: bpMoxR" amino acids 11 to 213 (203 residues), 189.5 bits, see alignment E=1e-59 PF07728: AAA_5" amino acids 42 to 171 (130 residues), 95 bits, see alignment E=1e-30 PF17868: AAA_lid_8" amino acids 229 to 289 (61 residues), 72.8 bits, see alignment E=4.1e-24 PF20265: LARA_dom" amino acids 334 to 436 (103 residues), 112.8 bits, see alignment E=2.4e-36 PF12592: ATPase_RavA_C" amino acids 443 to 497 (55 residues), 57.4 bits, see alignment 2.9e-19

Best Hits

Swiss-Prot: 78% identical to RAVA_YERE8: ATPase RavA (ravA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 96% identity to spe:Spro_4903)

MetaCyc: 69% identical to regulatory ATPase RavA (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Putative regulator protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>IAI46_25085 ATPase RavA (Serratia liquefaciens MT49)
MAPSSLLAERISRLSSALESGLYERQEAIRLCLLAALSGESVFLLGPPGIAKSLIARRLK
FAFRHARSFEYLMTRFSTPEEVFGPLSIQALKDEGRYQRLTAGYLPEAEIVFLDEIWKAG
PAILNTLLTAINERRFRNGNAEEPIPLRLLVTASNELPEADSSLEALYDRMLIRLWLDKV
QDKQNFRSLLVSRQNENENPVPEALSITDEEYHQWQSQIDKIKLPESCFELIFQLRQRLD
ALDHAPYVSDRRWKKALRLLQACAFFSGRDAVAPIDLLLLKDCLWHDLTSLKLLQQQVEQ
LLNESAYQQQTLLIQLQQIHTRWLQHQQQQSDSQAITLVKKGGMFSRKPQFALATPLGTG
PLTLLLQKPLQLHDIQVNHLSIENSVLENWLQKGGDVRAKLNGIGFAQQIDLEVDEKLHL
TVLDVSRQPSLLALPGIKTGGTPQAMLDEMDQLAQRLAEQRRLFSQHQPCLFTPAARLAK
IEASLLQVAEQIKQQHQQMRGQ