Protein Info for IAI46_25065 in Serratia liquefaciens MT49

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 315 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 44 to 313 (270 residues), 157.9 bits, see alignment E=1.5e-50

Best Hits

Swiss-Prot: 90% identical to RBSC_ECOLI: Ribose import permease protein RbsC (rbsC) from Escherichia coli (strain K12)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 99% identity to spe:Spro_4899)

MetaCyc: 90% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>IAI46_25065 ribose ABC transporter permease (Serratia liquefaciens MT49)
MSSQSVAKRWFSKEWLLEQKSLIALLVLIAVVSSMSPNFFTLNNLFNILQQTSVNAIMAV
GMTLVILTSGIDLSVGSLLALTGAVAASIVGFEVNAVVAVAAALALGAAVGACTGVIVAK
GKVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFTDVADTFGWFGIGRPLGVPTPIWIMAI
VFIAAWYMLHHTRLGRYIYALGGNEAATRLSGISVDKVKIIVYSLCGLLAALAGVIEVAR
LSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYY
QMIVKAVVILLAVLVENKSNK