Protein Info for IAI46_24935 in Serratia liquefaciens MT49

Annotation: virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 165 (30 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 242 to 268 (27 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 19 to 277 (259 residues), 311.9 bits, see alignment E=2.2e-97 PF03631: Virul_fac_BrkB" amino acids 30 to 276 (247 residues), 208 bits, see alignment E=9.7e-66

Best Hits

Swiss-Prot: 96% identical to Y4878_SERP5: UPF0761 membrane protein Spro_4878 (Spro_4878) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07058, membrane protein (inferred from 96% identity to spe:Spro_4878)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>IAI46_24935 virulence factor BrkB family protein (Serratia liquefaciens MT49)
MSFFRRKKLPASIKPSVTFLRLLIKRVDSDGLTMLAGHLAYVSLLSLVPLVTVVFALFAA
FPMFSDISVQLKSFIFSNFMPAAGNVIQSYLEQFVANSNKMTAVGTCGLIVTALLLISSV
DSVLNTIWRSKNQRPIVFSFAVYWMVLTLGPLLVGASMAISSYLLSLNWLAQTGVNSLVD
QVLRIFPLILSWISFWLLYCIVPTVRVPPKDALIGALVAGLLFELGKKGFALYVTMFPSY
QLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTIGEYRDYRQQKAQQQEQSSEGQL