Protein Info for IAI46_24910 in Serratia liquefaciens MT49

Annotation: sodium/glutamate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 369 to 396 (28 residues), see Phobius details TIGR00210: sodium/glutamate symporter" amino acids 2 to 397 (396 residues), 625.8 bits, see alignment E=1.3e-192 PF03616: Glt_symporter" amino acids 2 to 366 (365 residues), 532.8 bits, see alignment E=1.9e-164

Best Hits

Swiss-Prot: 80% identical to GLTS_SHIFL: Sodium/glutamate symporter (gltS) from Shigella flexneri

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 97% identity to srs:SerAS12_4959)

MetaCyc: 80% identical to glutamate:sodium symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122

Predicted SEED Role

"Sodium/glutamate symport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>IAI46_24910 sodium/glutamate symporter (Serratia liquefaciens MT49)
MFHLDTYGTLVAATLVLLLGGKCVTSIPLLRKYTIPAPVAGGLLVALLLLALKKFVNWEI
SFDMSLKDPLMLAFFATIGLNANLSRLRAGGKALMVFLFVVLGLLLVQNAIGIGMAKMLG
LDPLMGLIAGSITLSGGHGTGAAWSKLFIERYGFENATEVAMACATFGLVLGGLIGGPVA
RYLVKHSSTPEGSPDDSVQPSGFEKPESGRLITSLIMIETIAMIAICLSLGQFISGLLSG
TVFELPNFVCVLFVGVILSNTLAFTGFYTVFERAVSVLGNVSLSLFLAMALMSLRLWELA
SLALPMLAILAVQTLVMALYAIFVTYRVMGKNYDAAVLAAGHCGFGMGATPTAIANMQAI
TDRFGPSHLAFLVVPMVGAFFIDIANAIVIKLYLLLPVFPAIG