Protein Info for IAI46_24865 in Serratia liquefaciens MT49

Annotation: NupC/NupG family nucleoside CNT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 241 to 266 (26 residues), see Phobius details amino acids 268 to 296 (29 residues), see Phobius details amino acids 333 to 357 (25 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF01773: Nucleos_tra2_N" amino acids 9 to 82 (74 residues), 69.6 bits, see alignment E=4.1e-23 PF07670: Gate" amino acids 91 to 190 (100 residues), 53.4 bits, see alignment E=4.7e-18 PF07662: Nucleos_tra2_C" amino acids 193 to 391 (199 residues), 202.3 bits, see alignment E=1.1e-63

Best Hits

Swiss-Prot: 72% identical to NUPC_ECOLI: Nucleoside permease NupC (nupC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_4947)

MetaCyc: 72% identical to nucleoside:H+ symporter NupC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-108A; TRANS-RXN-108B; TRANS-RXN-108C; TRANS-RXN-108D; TRANS-RXN-108E; TRANS-RXN-108F; TRANS-RXN-108G; TRANS-RXN-108H; TRANS-RXN-108I; TRANS-RXN-476

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>IAI46_24865 NupC/NupG family nucleoside CNT transporter (Serratia liquefaciens MT49)
MPQILQFIFALVVIIALALLVSNDRKKIRLRYIIQLLVIEGALAYFFLHSESGLSVIKHV
AGFFETLLTYAAQGSDFVFGGMSKDGLAFIFLGVLCPIIFISALIGILQHFRILPLIIRL
VGTLLSKVNGMGKLESFNAVSTLVLGQSENFIAYKGIIGDISPRRMYTMAATAMSTVSMS
IVGAYMSMIDAQYVVAALILNMFSTFIILSIINPYQLDDEPELKLSKLHEDQSFFEMLGE
YILAGFKIAMIIAAMLIGFIALISAVNALFSAVFGISFQQILGYVFYPLAWLIGIPAPDA
LRAGSIMATKLVANEFVAMIELKKIATELSPRGLGILSVFLVSFANFASIGIVAGAIKGL
NERQGNVVSRFGLKLVYGSTLVSLLSAAIAGLVL