Protein Info for IAI46_24860 in Serratia liquefaciens MT49

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00106: adh_short" amino acids 7 to 193 (187 residues), 185.6 bits, see alignment E=1.5e-58 PF08659: KR" amino acids 9 to 159 (151 residues), 56.6 bits, see alignment E=6.4e-19 PF13561: adh_short_C2" amino acids 13 to 223 (211 residues), 129 bits, see alignment E=4.6e-41

Best Hits

Swiss-Prot: 49% identical to Y452_LISIN: Uncharacterized oxidoreductase Lin0452 (lin0452) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: None (inferred from 76% identity to spe:Spro_3865)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>IAI46_24860 SDR family oxidoreductase (Serratia liquefaciens MT49)
MSQISGKVVIITGASSGLGEATARHLAARGATVVLAARRKTRLDALANEIISAGGKALAV
AVDVTRRNDVEAMVDAAITEFGRVDVLVNNAGLMAIAPLSATRVDEWERMIDINLKGVLY
GIAAALPVFEQQQSGHFINVASVAGLKVLSPGGAVYSGTKFAVRAISEGLRYEVGAHIRT
TIICPGAVDSELKLGTSDRESVKFVEAFYQQAIPADSVARAIAYAIEQPAEVDINEIVLR
PTQELY