Protein Info for IAI46_24825 in Serratia liquefaciens MT49

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF20582: UPF0758_N" amino acids 6 to 82 (77 residues), 78 bits, see alignment E=4.6e-26 TIGR00608: DNA repair protein RadC" amino acids 15 to 227 (213 residues), 269.7 bits, see alignment E=9.8e-85 PF04002: RadC" amino acids 108 to 226 (119 residues), 154.7 bits, see alignment E=1e-49

Best Hits

Swiss-Prot: 97% identical to Y4842_SERP5: UPF0758 protein Spro_4842 (Spro_4842) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 97% identity to spe:Spro_4842)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>IAI46_24825 DNA repair protein RadC (Serratia liquefaciens MT49)
MSSQVITLWQDTLAPREKLLRYGASALSDAELLAIFLRTGFPGVHVMQLAEQLLAQFGSL
YHLMSADHSVFCSHKGLGNSSYAQLQAISELAFRFFSSHLAQENAMLNPKMTQHYLQSLL
AHHEREVFLVLFLDNQHRVIRHQEMFAGTISSVVVYPREIVREALKANAAAIILAHNHPS
GKAEPSHADRLITEQVVNACLLLEIRVLDHLVIGRGECVSFAERGWL