Protein Info for IAI46_24690 in Serratia liquefaciens MT49

Annotation: NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 8 to 164 (157 residues), 183.2 bits, E=1.1e-57
• PF03446: NAD_binding_2
  • amino acids 8 to 124 (117 residues), 22.2 bits, E=3.7e-08
• PF02558: ApbA
  • amino acids 9 to 115 (107 residues), 36.9 bits, E=8.4e-13
• PF03807: F420_oxidored
  • amino acids 9 to 98 (90 residues), 24.9 bits, E=7.9e-09
• PF07479: NAD_Gly3P_dh_C
  • amino acids 184 to 323 (140 residues), 196.7 bits, E=6.4e-62
• PF20618: GPD_NAD_C_bact
  • amino acids 244 to 310 (67 residues), 91.8 bits, E=9.6e-30

Best Hits

Swiss-Prot: 98% identical to GPDA_SERP5: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 98% identity to spe:Spro_4815)

MetaCyc: 86% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• 1,3-propanediol biosynthesis (engineered) (7/9 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Protein Sequence (339 amino acids)

>IAI46_24690 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (Serratia liquefaciens MT49)
MNSVNASMTVIGAGSYGTALAITLARNGHSVVLWGHNPEQIQKMQHDRCNQAFLPDVTFP
DTLLLEADLARALAASRDVLVVVPSHVFGDVLRQLKPHLRPDARIVWATKGLEAETGRLL
QDVAREALGEAIPLAVVSGPTFAKELAAGLPTAIALASTDAQFADDLQQLLHCGKSFRVY
SNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGLTEMTRLGSALGADPSTF
MGMAGLGDLVLTCTDNQSRNRRFGIMLGQGKGVQEAQDSIGQVVEGYRNTKEVLALAQRH
GVEMPITEQIYQVLYCHKDAREAALSLLGRTRKDEKHNA