Protein Info for IAI46_24665 in Serratia liquefaciens MT49

Annotation: envelope stress sensor histidine kinase CpxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF16527: CpxA_peri" amino acids 81 to 159 (79 residues), 43.3 bits, see alignment E=9.8e-15 PF00672: HAMP" amino acids 182 to 234 (53 residues), 41.7 bits, see alignment 2.3e-14 PF00512: HisKA" amino acids 239 to 300 (62 residues), 54 bits, see alignment E=2.8e-18 PF02518: HATPase_c" amino acids 349 to 455 (107 residues), 82.4 bits, see alignment E=6.6e-27

Best Hits

Swiss-Prot: 84% identical to CPXA_ECOLI: Sensor histidine kinase CpxA (cpxA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_4907)

MetaCyc: 84% identical to sensor histidine kinase CpxA (Escherichia coli K-12 substr. MG1655)
Protein-histidine tele-kinase. [EC: 2.7.13.2]

Predicted SEED Role

"Copper sensory histidine kinase CpxA" in subsystem Orphan regulatory proteins

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.13.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>IAI46_24665 envelope stress sensor histidine kinase CpxA (Serratia liquefaciens MT49)
MINSLTARIFAIFWFTLALVLMLVLMVPKLDSRQMTSLLDSEQRQGLMLEQHVEAELQND
PANDLMWWRRLFRAIEKWAPPGQRLLLVTSEGRVIGNMQRNEMQLVRNFIGQSDNADHPK
KKKYGRVELVGPFSVRDGEDNYQLYLIRPANSPQSDFINLMFDRPLLLLIVTMLISAPLL
LWLAWSLAKPARKLKNAADDVARGNLKQHPELEAGPQEFLATGASFNQMVSALERMMTAQ
QRLISDISHELRTPLTRLQLATALMRRRHGEGHELARIETEAQRLDSMINDLLVLSRGQQ
KSELVRERLLANELWADVLDDASFEAEQMGKQLEITSPPGPWTLYGNAGALDSALENIVR
NALRYSNTHIAVAFSADNQGITIVVDDDGPGVSAEDREQIFRPFYRTDEARDRASGGTGL
GLAIVEAAVNQHRGWVKAEDSPLGGLRLVLWLPLHQR