Protein Info for IAI46_24610 in Serratia liquefaciens MT49

Annotation: multidrug efflux MFS transporter EmrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 45 to 63 (19 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 350 (337 residues), 134.6 bits, see alignment E=6.4e-43 PF00083: Sugar_tr" amino acids 47 to 191 (145 residues), 36.1 bits, see alignment E=5.7e-13 PF06609: TRI12" amino acids 49 to 183 (135 residues), 25.1 bits, see alignment E=9.1e-10

Best Hits

Swiss-Prot: 72% identical to EMRD_ECOLI: Multidrug resistance protein D (emrD) from Escherichia coli (strain K12)

KEGG orthology group: K08154, MFS transporter, DHA1 family, 2-module integral membrane pump EmrD (inferred from 97% identity to spe:Spro_4800)

MetaCyc: 72% identical to multidrug efflux pump EmrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-339; TRANS-RXN-44

Predicted SEED Role

"Multidrug resistance protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>IAI46_24610 multidrug efflux MFS transporter EmrD (Serratia liquefaciens MT49)
MRKIENFHLLVMLILLVAVGQMAQTIYVPVIADIAKDLSVRSGAVQRVMAAYLMTYGFSQ
LIYGPLSDRIGRRPVILAGMMIFLMGALGALLSNSLTMLVVASAIQGMGTGVAGVMARTM
PRDLYAGTSLRYANSLLNMGILVSPLLAPIIGGALAMVFGWRACYAFLLVLCAGVAFSMF
RWLPETRPQQTEKRRMLASFRKLLADGTFSCYLVMLIGALAGIAVFEASCGVLMGGVLGL
SGLTVSLLFILPIPAAFFGAWYAGRDGKTFHTLVWHSVISCLLAGLMMWIPGWFGVMNIW
TLIVPAALFFFGAGMMFPLATTGAMEPFPYLAGAAGALVGGMQNMGSGLATWLSAMLPQT
GQFSLGLLMFAMALLILLCWWPLSNRMQHQGHTA