Protein Info for IAI46_24570 in Serratia liquefaciens MT49

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 2 to 172 (171 residues), 288 bits, E=1e-90
• PF00227: Proteasome
  • amino acids 2 to 169 (168 residues), 90.5 bits, E=5.7e-30

Best Hits

Swiss-Prot: 100% identical to HSLV_SERP5: ATP-dependent protease subunit HslV (hslV) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 99% identity to srs:SerAS12_4889)

MetaCyc: 93% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Protein Sequence (176 amino acids)

>IAI46_24570 ATP-dependent protease subunit HslV (Serratia liquefaciens MT49)
MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVKKVRRLYNDKVIAGFAGGTADAFTLFEL
FERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADENSSLIITGNGDVIQPENDL
IAIGSGGPYAQAAARAMLENTELSAREIVDKSLNIAGDICIYTNHFHTIEELPSKA