Protein Info for IAI46_24545 in Serratia liquefaciens MT49

Annotation: met regulon transcriptional regulator MetJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01340: MetJ" amino acids 3 to 99 (97 residues), 194 bits, see alignment E=1.4e-62

Best Hits

Swiss-Prot: 100% identical to METJ_SERP5: Met repressor (metJ) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03764, transcriptional repressor of met regulon (beta-ribbon, MetJ family) (inferred from 94% identity to dze:Dd1591_0119)

Predicted SEED Role

"Methionine repressor MetJ" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>IAI46_24545 met regulon transcriptional regulator MetJ (Serratia liquefaciens MT49)
MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPNDEDLRKERSDEIPEAAKLLMRELGVDPDTWEY