Protein Info for IAI46_24485 in Serratia liquefaciens MT49

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF07992: Pyr_redox_2" amino acids 7 to 326 (320 residues), 140.1 bits, see alignment E=2.6e-44 PF01134: GIDA" amino acids 7 to 144 (138 residues), 32.3 bits, see alignment E=1.5e-11 PF00070: Pyr_redox" amino acids 174 to 224 (51 residues), 25.3 bits, see alignment 4.6e-09 PF02852: Pyr_redox_dim" amino acids 349 to 458 (110 residues), 64.5 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_4871)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>IAI46_24485 dihydrolipoyl dehydrogenase (Serratia liquefaciens MT49)
MKQLNVDVAVIGGGTAGLGAYRAAKLATPSVVMIEGGAYGTTCARVGCMPSKLLIAAAEA
VHQIERAPGFGVYPAGKTTINGREVMDRVKRERDRFVGFVLEGVDEIPATDKIQGYARFI
DDNTLQVDDHTRIVAQRIVIATGSRPSWPAAWNALGDRLIVNDDVFNWTDLPDSVAVFGP
GVIGLELGQALHRLGVETKVFGVGGAVGPLTDSTVRNYAAKALGEEFYLDADVKVDMMQR
EGDKVFIRYQGLNGLPQEIMVDYVLAATGRRPNVDNLDLENTRLVLDARGVPQADRLTMQ
TNVPHIFIAGDASNQLPLLHEASDQARIAGTNAGSFPEVTPGLRRSAISVVFSDPQIAMV
GSTFRELNEKFSACGCFEIGEVSFENQGRSRVMLRNKGILHVYGEQGTGRFLGAEMMGPD
VEHIAHLLAWAHQQKMTINQMLDMPFYHPVIEEGLRTALRDLQSKLKLGEAEAERCQRCP
GE