Protein Info for IAI46_24385 in Serratia liquefaciens MT49

Annotation: HTH-type transcriptional regulator HdfR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00126: HTH_1" amino acids 4 to 62 (59 residues), 76.2 bits, see alignment E=1.6e-25 PF03466: LysR_substrate" amino acids 87 to 268 (182 residues), 69.3 bits, see alignment E=3.3e-23

Best Hits

Swiss-Prot: 65% identical to HDFR_SALNS: HTH-type transcriptional regulator HdfR (hdfR) from Salmonella newport (strain SL254)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_4764)

Predicted SEED Role

"HTH-type transcriptional regulator hdfR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>IAI46_24385 HTH-type transcriptional regulator HdfR (Serratia liquefaciens MT49)
MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGANLFTRHRNNIRLTPA
GERLLPYAESLMMTWQLAKKEVVRSLQHTELSIGATASLWEAYLTPWLQSLYQQREALQL
EARVALRHSLVKQLHERQLDLLITTEPPKMDELASQLLGNFSLRLFSSTLRDQHAPMPYI
KLEWGADFHQQESRMLESDTLPVLTTTSAHLTRQLLETTGGCAFLPSQWENDYPQLTAIA
EIPAIIRPLYAVWLQNSDQQPLIRQLLKIPLKTSA