Protein Info for IAI46_24380 in Serratia liquefaciens MT49

Annotation: DUF413 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF04219: DUF413" amino acids 10 to 97 (88 residues), 128.1 bits, see alignment E=5e-42

Best Hits

Swiss-Prot: 80% identical to YIFE_ECO57: UPF0438 protein YifE (yifE) from Escherichia coli O157:H7

KEGG orthology group: K09897, hypothetical protein (inferred from 96% identity to spe:Spro_4763)

Predicted SEED Role

"Protein yifE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>IAI46_24380 DUF413 domain-containing protein (Serratia liquefaciens MT49)
MADSFTTTSRFFDNKHYPRGFSRHGDFTIKEAQLLERFGYAFNELDTGKRQPATEEEQLF
VAVCHGEREPVTEQEKVWAKYLARTRRPKKFHTLSGGKPQADAVEDYTDSED