Protein Info for IAI46_24375 in Serratia liquefaciens MT49

Annotation: YifB family Mg chelatase-like AAA ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR00368: Mg chelatase-like protein" amino acids 6 to 493 (488 residues), 724.1 bits, see alignment E=4.1e-222 PF13541: ChlI" amino acids 21 to 142 (122 residues), 150.7 bits, see alignment E=6.3e-48 PF01078: Mg_chelatase" amino acids 190 to 389 (200 residues), 303.6 bits, see alignment E=2.1e-94 PF07728: AAA_5" amino acids 213 to 351 (139 residues), 38 bits, see alignment E=5.6e-13 PF00493: MCM" amino acids 288 to 383 (96 residues), 41.3 bits, see alignment E=3.5e-14 PF13335: Mg_chelatase_C" amino acids 401 to 493 (93 residues), 102.8 bits, see alignment E=4.3e-33

Best Hits

Swiss-Prot: 65% identical to YIFB_ECOLI: Uncharacterized protein YifB (yifB) from Escherichia coli (strain K12)

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 94% identity to spe:Spro_4762)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>IAI46_24375 YifB family Mg chelatase-like AAA ATPase (Serratia liquefaciens MT49)
MSLAVIYTRATLGVQAPSVTVEVHISNGLPGLTMVGLPETTVKEARDRVRSALINNGFTF
PARRITVNLAPADLPKEGGRYDLPIALAILAASEQLPADKLAHYEFLGELALSGALRGVS
GAIPAALAAMESGRQLVLAAANGPEVGLITQSKTLVADHLLEVCAFVLGKEDLPVAHAPP
AMNNAPEPADLQDILGQEQAKRALEIAAAGGHNLLLVGPPGTGKTMLASRLNGLLPPLTD
QEALESIAVASLLHHAAQALPWRQRPFRAPHHSASMAALVGGGSLPRPGEISMAHNGVLF
LDELPEFERRVLDALREPLESGEIVVSRASAKVCFPARVQLIAAMNPSPTGHYQGMHNRA
SPQQVLRYLGRLSGPFLDRFDLSIEVPLLPPGLLSKKRIAGENSAQVRERVLLARERQLS
RAGKINALLNNHEVERDCRLNDADADFLETTLNRLGLSVRAWQRILKVARTLADLAGDRA
IDKRHLSEALGYRSMDRLLLQLHRSLE