Protein Info for IAI46_24340 in Serratia liquefaciens MT49

Annotation: threonine ammonia-lyase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 15 to 512 (498 residues), 873.4 bits, see alignment E=2.2e-267 PF00291: PALP" amino acids 30 to 316 (287 residues), 266.3 bits, see alignment E=3.6e-83 PF00585: Thr_dehydrat_C" amino acids 329 to 419 (91 residues), 95.1 bits, see alignment E=1.8e-31 amino acids 425 to 512 (88 residues), 97 bits, see alignment E=4.8e-32

Best Hits

Swiss-Prot: 86% identical to ILVA_ECOLI: L-threonine dehydratase biosynthetic IlvA (ilvA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_4849)

MetaCyc: 86% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>IAI46_24340 threonine ammonia-lyase, biosynthetic (Serratia liquefaciens MT49)
MAVSQPLPDAPCGAEYLRAVLRSPVYEVAQVTPLQAMSKISSRLGNTILVKREDRQPVHS
FKLRGAYAMIASLNEEQKARGVVTASAGNHAQGVAYSGKRLGIKTLIVMPVSTADIKVDA
VRGFGGEVLLHGANFDEAKARAIELSHKQGMTFVPPFDHPTVIAGQGTLAMELLQQDAHL
DRVFVPVGGGGLAAGVAVLIKQLMPQIKVIGVEAEDSACLRAALDAGHPVDLARVGLFAE
GVAVKRIGDETFRLCREYLDDVITVDSDAICAAVKDLFEDVRAIAEPSGALALAGLKKYV
QQHNIQGERLAHVLSGANLNFHGLRYVSERCELGEQREALLAVTIPEQKGSFLKFCQLLG
GRSVTEFNYRYADADNACIFVGVRLTRGHAERLEIIDELNADGYQVVDLSDDEMAKLHVR
YMVGGRPSKPLRERLYSFEFPESPGALLKFLQTLGTHWNISLFHYRSHGTDFGRVLAGFE
LSQTEPEFEQHLQALGYDCHDETDNPAFRFFLQG