Protein Info for IAI46_24250 in Serratia liquefaciens MT49

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details PF00512: HisKA" amino acids 227 to 291 (65 residues), 36.1 bits, see alignment E=8.3e-13 PF02518: HATPase_c" amino acids 338 to 451 (114 residues), 94.9 bits, see alignment E=6.6e-31 PF00072: Response_reg" amino acids 475 to 586 (112 residues), 64.4 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 94% identity to spe:Spro_4735)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>IAI46_24250 response regulator (Serratia liquefaciens MT49)
MKLTGFKSGSRLAIPAIFAALFLVASTVTLYYYSATLSKKGLYAIAGTQENYSWSIAKFS
IKLAEFDTLVEQLKNAPQVDSEDLRLKFEILYSRFYVLETVSESTQPLYAEPGYPEVVTH
MREKMDQIDNLLNSPKIDFSLISQAMKQIKPYAIEMANLTDHAEVKQRTAAYEDYIEKRH
IIFYGLVIVMFSVIALIAITLIVLRQQRLTIRQQAKAIEAEKATRTKNAFLGAIGHELRT
SLQSIMSAIDVLVNTQVSAEHADTFQRLETAAQQIESQMKDLTDYAHLDSGMMELRIAPF
DAQRLVEETANEIKTLRQKDQVTLLCEVECGHLQIHSDPLRIRQIIVNLLTNAFKYTESG
TITLHSCLRSQATGSSLIIEVTDTGIGIEKGMLDQIFRPFTQLDQSHTRQYGGVGMGLAI
VHGLVTLLNGTITVYSEIKKGSTFIVSIPVEVSHEEELGETPLHQQSLPQKQQHILVVDD
NKSVSDAFSALLDKLGYQHELCNSSERALQKLLRRPYDALLLDLQMPGIDGAALAKKLRD
QRGPNRHIPIIGISAYTPEQLSVEQRALFDNYLMKPVRLDALSSALASLLAAKG