Protein Info for IAI46_24190 in Serratia liquefaciens MT49

Annotation: FGGY-family carbohydrate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 477 to 495 (19 residues), see Phobius details PF00370: FGGY_N" amino acids 4 to 262 (259 residues), 104.6 bits, see alignment E=6.8e-34 TIGR01315: FGGY-family pentulose kinase" amino acids 5 to 538 (534 residues), 696.5 bits, see alignment E=1.3e-213 PF02782: FGGY_C" amino acids 281 to 489 (209 residues), 169.3 bits, see alignment E=9.5e-54

Best Hits

Swiss-Prot: 50% identical to FGGY_MOUSE: FGGY carbohydrate kinase domain-containing protein (Fggy) from Mus musculus

KEGG orthology group: None (inferred from 98% identity to srs:SerAS12_4799)

Predicted SEED Role

"D-ribulokinase (EC 2.7.1.47)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 2.7.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>IAI46_24190 FGGY-family carbohydrate kinase (Serratia liquefaciens MT49)
MASYFIGVDVGTGSARAGVFDLNGHMVGQASRTIDLYRPKADFVEQSSDNIWQAVCNAVR
DAVNQADINPIQVKGLGFDATCSLVVLDKEGQPLTVSPSGRTEQNIIVWMDHRAITQAER
INATKHRVLDFVGGIISPEMQTPKMLWLKQHMPTTWANAGYLFDLPDFLTWRATQDATRS
LCSTVCKWTYLGHEQRWDKSYFKQIGLEDVLEHDAAKIGSDVKMMGEPLGHGLTQRAASE
MGLIAGTAVSVSIIDAHAGTLGTLGATGVSGEVADFNRRVALIGGTSTGHMAMSRTARFI
GGVWGPYYSAILPEYWLNEGGQSATGALIDHVIQSHPCYPELLAQAKTQGQTIYEVLNAL
LRRMAGEPEEIAFLTQDIHMLPYFHGNRSPRANPTLTGTLTGLKLSRTPEDMALHYLATI
QAIALGTRHIIETMNQSGYSIDTIMASGGGTKNPIFVQEHANATGCAMLLPEESEAMLLG
GAMMGTVAAGVYDTLPEAMSAMSRIGKTVTPQTNKIKRYYDRKYRVFHELYNDHMKYRQL
MQEEA