Protein Info for IAI46_24185 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 124 (30 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 44 to 309 (266 residues), 113.2 bits, see alignment E=6.3e-37

Best Hits

Swiss-Prot: 36% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 98% identity to spe:Spro_4696)

MetaCyc: 32% identical to Autoinducer-2 ABC transporter membrane subunit LsrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease component 1" in subsystem D-ribose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>IAI46_24185 ABC transporter permease (Serratia liquefaciens MT49)
MIQLTRLIPNDRIIRLQSAIIIAVALLFAGLLGSRFFSLGNFQSIASQLPILGMLALGMG
ITMLTGGINLSIIAGANACSLVMAAIIVSHPDQPLFLALALLAGLLVAVAIGALNGVLVA
WIGVSPILASLGTMTLITGLNILLSNGAVISGFPAAIQYLGNGSLLGIPVALLLFLLVSV
GLWLLLEHTTLGRSLYLIGSNEQATRFSGVNTARVQIAVYILSALLGWGAALLMMAKFNS
AKAGYGESYLLVTILASVLGGINPDGGFGRVLGLVLALIVLQMLESGLNLLGVSSYLTMA
LWGGVLILFIALQNRKA