Protein Info for IAI46_24035 in Serratia liquefaciens MT49

Annotation: iron export ABC transporter permease subunit FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details TIGR00245: TIGR00245 family protein" amino acids 7 to 251 (245 residues), 350.2 bits, see alignment E=3.1e-109 PF03649: UPF0014" amino acids 10 to 245 (236 residues), 276.5 bits, see alignment E=9.1e-87

Best Hits

Swiss-Prot: 83% identical to FETB_ECOLI: Probable iron export permease protein FetB (fetB) from Escherichia coli (strain K12)

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 96% identity to srs:SerAS12_4761)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>IAI46_24035 iron export ABC transporter permease subunit FetB (Serratia liquefaciens MT49)
MNQHNISNESLALSMVLVIIAILISHKEKLALEKDIIWSICRAVVQLIIVGYVLKYIFDV
NNAILTVLMVLFICFNAAYNAQKRSKYIEHAFMTSFIAITTGAVLTLAVLVLTGSIEFTP
MQVIPISGMVAGNAMVAVGLCYNNLGQRFKSDQQKIQEMLSLGASPKFASAALIRDSIRA
SLIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVTFMLLSTASLSTIIACYLA
YRKFYNERHQLVVSTLK