Protein Info for IAI46_24025 in Serratia liquefaciens MT49

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 327 to 344 (18 residues), see Phobius details amino acids 350 to 375 (26 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 5 to 453 (449 residues), 369.3 bits, see alignment E=1.4e-114 PF00083: Sugar_tr" amino acids 16 to 456 (441 residues), 367.2 bits, see alignment E=1.3e-113 PF07690: MFS_1" amino acids 20 to 401 (382 residues), 130.4 bits, see alignment E=7.6e-42

Best Hits

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_4758)

Predicted SEED Role

"Major myo-inositol transporter IolT" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>IAI46_24025 sugar porter family MFS transporter (Serratia liquefaciens MT49)
MSSQRKHNTGYILRICGIAALGGILFGYDTAVISGAIESLKTYFNLSPAETGWAVSNVVI
GCVVGAFAAGPLAGRYGRKKALMLAAVLFTISAVGSSLAPTFTWFVIYRIIGGLAVGIAA
TVSPMYMSEVSPKDMRGRALSMQQFAIVFGQIVIFYVNFKIASIASEAWLVEMGWRWMFA
SGVLPCILFCILVFIIPESPRWSVMVGRDDQALAMLTKVSNAEHAKKVLQEIKDSIKQDQ
QASQKKLSYADKRVRFILFVGCMIAMLQQVTGVNVMMYYAPVVLKTVTVNAQEALFQTIW
IGVMQLVGSVIGAMLMDRMGRIPLMRWGTLGVIAGLLITSYALYTEATGYFALFGMLFFM
VFYALSWGVGAWVLVSEIFPNRMRSQGMSIAVGCMWLANFVVSQTFPMINDNPYLFSSFH
GAFPMWVFAVCCLFSYWFIGRYIPETRGVSLEKMEDVVMAKRYRQPQPEIQRTPL