Protein Info for IAI46_23795 in Serratia liquefaciens MT49

Annotation: transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01461: transcription elongation factor GreB
  • amino acids 3 to 157 (155 residues), 273 bits, E=3e-86
• PF03449: GreA_GreB_N
  • amino acids 5 to 74 (70 residues), 89.9 bits, E=9.9e-30
• PF01272: GreA_GreB
  • amino acids 81 to 155 (75 residues), 80.8 bits, E=5.7e-27

Best Hits

Swiss-Prot: 87% identical to GREB_SALTI: Transcription elongation factor GreB (greB) from Salmonella typhi

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 95% identity to spe:Spro_4626)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Protein Sequence (157 amino acids)

>IAI46_23795 transcription elongation factor GreB (Serratia liquefaciens MT49)
MRTQLITREGYDKLKQELDFLWREDRPEVTKKVTWAASLGDRSENADYQYNKKRLREIDR
RVRYLTKCLEQLKIVDYSPQQEGKVFFGAWVVVENEDGDTKRFRIVGYDEIFGRRDYISI
DSPMARALLKKEVGDAATVNTPVGDALWYVNEIEYVK