Protein Info for IAI46_23715 in Serratia liquefaciens MT49

Annotation: DNA uptake porin HofQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 24 to 411 (388 residues), 404.3 bits, see alignment E=3.3e-125 PF03958: Secretin_N" amino acids 118 to 182 (65 residues), 48.2 bits, see alignment E=1e-16 PF00263: Secretin" amino acids 252 to 412 (161 residues), 167.8 bits, see alignment E=1.7e-53

Best Hits

KEGG orthology group: K02507, protein transport protein HofQ (inferred from 90% identity to spe:Spro_4606)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>IAI46_23715 DNA uptake porin HofQ (Serratia liquefaciens MT49)
MKGCRWLAVLLWGSAFANIAQEPDPISLEFQDAPVAVVLQALADHQQLNVVTAAGVGGNL
TLRLDKVPWRQALAVILRMGKLTMTLEGNVMMVFPEPSEQEKQRQQLALAQKQPLHSVTL
PLNHADATEIAENLNAQDGTLLSERGSLVADKRTNAVLLRDTAPIVALLTQRIAEMDVPL
AQVQLAAHIVTINSESLRELGVRWGLAPDERPAKSWQLDGFNVALPLERSAVSAGFHLAR
IGGRLLDLELMALEQENRVEIIASPRLLTANLQTASIKQGTEIPYEVNSGASGATSIEFK
EAVLGMEVTPKILPNGRITLTLQISQNMPGRSISRATGETLAIDKQEIKTQVTVKDGETI
VLGGVFQRHSAQGADKVPGIGDVPLLGSLFKQSSKQHKRRELVIFITPTLIKA